Protein Info for PS417_08945 in Pseudomonas simiae WCS417

Annotation: heat shock protein 90

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 PF02518: HATPase_c" amino acids 32 to 184 (153 residues), 28.3 bits, see alignment E=3.1e-10 PF13589: HATPase_c_3" amino acids 33 to 153 (121 residues), 36.9 bits, see alignment E=5.3e-13 PF00183: HSP90" amino acids 227 to 629 (403 residues), 434.3 bits, see alignment E=1.2e-133

Best Hits

Swiss-Prot: 99% identical to HTPG_PSEFS: Chaperone protein HtpG (htpG) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 99% identity to pfs:PFLU1830)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZT5 at UniProt or InterPro

Protein Sequence (634 amino acids)

>PS417_08945 heat shock protein 90 (Pseudomonas simiae WCS417)
MSVETQKETLGFQTEVKQLLHLMIHSLYSNKEIFLRELISNASDAVDKLRFEALSKPELL
EGGAELKIRVSFDKDAKTVTLEDNGIGMSREDAITHLGTIAKSGTADFMKNLSGDQKKDS
HLIGQFGVGFYSAFIVADKVEVFSRRAGLDASEGVHWSSKGEGEFEIATIDKADRGTRIV
LHLKSGEDEFADGWRLRNIVKKYSDHIALPIELPKEQAAAEGEEAPAQEWEVVNRASALW
TRPRTEIKDEEYQEFYKHIGHDYENPLSWSHNKVEGKLEYSSLLYVPARAPFDLYQREAP
KGLKLYVQRVFVMDQAESFLPLYLRFIKGVVDSNDLSLNVSREILQKDPIIDSMKSALTK
RVLDMLEKLAKNEPEQYKGFWKNFGQVMKEGPAEDFANKEKIAGLLRFASTHEEGGEQVV
SLAEYLARAKEGQDKIYYLTGETYAQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLNE
FDGKSFVDVARGDLDLGNLDSEEEKKEAEEVAKSKEGLVERIKASLGDAVSEVRVSHRLT
DSPAILAIGEQDLGMQMRQILEASGQKVPDSKPIFEFNPAHPLIEKLDGEQSEERFGDLS
HILFDQAALAAGDSLKDPAAYVRRLNKLLVELSV