Protein Info for GFF1754 in Variovorax sp. SCN45

Annotation: Nicel/Cobalt-specific TonB-dependent outer membrane receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 698 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07715: Plug" amino acids 55 to 159 (105 residues), 51.7 bits, see alignment E=1.2e-17 PF00593: TonB_dep_Rec_b-barrel" amino acids 225 to 648 (424 residues), 124.9 bits, see alignment E=8.4e-40

Best Hits

KEGG orthology group: None (inferred from 82% identity to aaa:Acav_3408)

Predicted SEED Role

"Nicel/Cobalt-specific TonB-dependent outer membrane receptor" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (698 amino acids)

>GFF1754 Nicel/Cobalt-specific TonB-dependent outer membrane receptor (Variovorax sp. SCN45)
MNLSSRASSRLPRPWLLGALFGSAAACAQQSHLPEIQIVGPRDAAIGTADSASEGAVERE
SFQSRPKLRPGDIVEAVPGVVATQHSGDGKANQYFLRGFNLDHGTDFAVTVDGMPVNMPT
HGHGQGYADLNFLIPELVSGVRYRKGPYFAQSGDFSLAGSASLDYFSALESPFAEVTAGS
HDFRRLLAAGSHTVQDQTWLGAIELEGNNGPWNVPENLKKANAVLRYSQGSQTRGFSVTA
MAYKSQWTSTDQVPERLIDSGELPRFGSLNPTDGGKTQRISLSGKWFDKGPNGDTEFSAY
AIDYRFDLFSDFTYFLNNPVNGDQFEQTDRRRIFGAQGSHAMANKIAGLDGLLSFGAQWR
GDRIGEVGLYDTEARQRLGTVRNDKVSQDLFSVYGQQLVNFSDRWRGYVGLRGDALRYNV
QGREPVYGPLNSGKGHDSQLSPKFGLAFSLTPAHEFYLNAGVGFHSNDVRGAVISTDPRS
GLPADRVPALVKGRGAEIGWRFQPDEDLTATVALWKLDLASELVYVGDAGTTEPGRASTR
RGLEATLRWKFDRAWRLEVDAAVSRARFKGAAPEGEGNYIDNAVERVLAAGITYIEGPWT
ASLRLRYMGPRALDTLNSVRSRASTLLNFGARYAVDKHLTLGLDVFNLAGRKGNDIEYYY
ASCTAGEVAGGTCNGGVNDRHIHPMEPRSVRVSARYTF