Protein Info for GFF1751 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 284 to 300 (17 residues), see Phobius details PF00892: EamA" amino acids 18 to 147 (130 residues), 44 bits, see alignment E=1.2e-15 amino acids 169 to 299 (131 residues), 64.3 bits, see alignment E=6.7e-22

Best Hits

KEGG orthology group: None (inferred from 82% identity to pol:Bpro_4235)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF1751 Permease of the drug/metabolite transporter (DMT) superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTAHSLPAQRWIDRPANKGLMLGLLGVVLFALTLPMTRLAVGTVDAPQMSGVFVALGRAV
VAALLSLVFLAATRAPLPRREDLVPLAVTAAGVVFGFPLFTSVAMRYVEAVHASVIVGVL
PLATAAVGALLHRQRPSTGFWLCAALGSGLVVGFAVLRSGSAGLTLHPADALLLAAMLCA
AVGYAYGARLSQRMRAEHVICWALVIALPLTLPLATLTRPQVALQASAWWGFAYTAVFSM
WIGFFAWYRGLALGGTVRVSQVQLVQPFLGMLFAVPLLGERLDAVTLGFAVAVIATVFIG
KKMPVHASARPEHV