Protein Info for GFF1750 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 201 (187 residues), 39.4 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: None (inferred from 72% identity to vei:Veis_0361)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF1750 Transporter, LysE family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSATELTALLLFCTAMSFSPGPNTTLSTALAANLGLRRALRFCFAVPTGWTLLMLACGLG
LGALVLGVPALRWGVKLLGVAYMLWLAWKLAGASKLSEVDASRLNVSFLQGVGLQFLNIK
AWMLALTLTAGWVVNAAGQPAPNPGQRLAIICVVMVFFAFTSNLTYAVAGSLLRQWLTQG
SRLIWFNRVLAAVLVATALWMLTV