Protein Info for GFF1747 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: COG0488: ATPase components of ABC transporters with duplicated ATPase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 PF00005: ABC_tran" amino acids 20 to 175 (156 residues), 88.9 bits, see alignment E=1.8e-28 amino acids 331 to 464 (134 residues), 80.6 bits, see alignment E=6.5e-26 PF12848: ABC_tran_Xtn" amino acids 214 to 289 (76 residues), 44.3 bits, see alignment E=5.6e-15 PF16326: ABC_tran_CTD" amino acids 560 to 627 (68 residues), 63 bits, see alignment E=8.6e-21

Best Hits

KEGG orthology group: None (inferred from 74% identity to vap:Vapar_4771)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>GFF1747 COG0488: ATPase components of ABC transporters with duplicated ATPase domains (Hydrogenophaga sp. GW460-11-11-14-LB1)
MALITLQDAQLAFGHVALLDHTDFALEAQERVGLIGRNGTGKSSLLKILASLEKADDGTL
QVQTGLRIAYVPQEPVLDLQSSVFEAASVGLADARAARDLYLSGADGLDLDALQNRIEAL
DAWNWEQRVEETLHRLHLDGAVRVGELSGGNKKRVALAQALVSRPDVLLLDEPTNHLDLD
SITWLEDLLLEYKGSVVTISHDRAFLDRVATRMVELDRGRLLSYPGNFAQYQLLKEEQMA
QEAVINARADKLLAQEEVWIRKGVEARRTRAQGRITRLERLREQRAQRRDAVGSVKLEVA
SGNASGKIVAELEKVTQTFSTTDGGQRTVIRDFSATILRGDKIGLIGPNGAGKTTLLKII
LGELIPTSGTVRQGSKTSVAYFDQMRDQLDLDATLEDFISPGSEWIEIGNKRTHVKSYLS
DFLFSPARANAPVRTLSGGERNRLLLARLFARPANVLVLDEPTNDLDIDTLELLEDLLQQ
YEGTVFLVSHDRRFLDNVVTSTLVFEGDGRWREYVGDVQDWLTQSARSAALQRERETPPP
APAPAAKPAAPAPAAAARKKLSYKEQREFDALPALIAALEAEQVTIGKDLENGQLFHSDP
ARAAQLGARHAEVEGEWLQALERWEALGGS