Protein Info for GFF174 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 53 to 77 (25 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 304 to 330 (27 residues), see Phobius details amino acids 337 to 387 (51 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details PF06808: DctM" amino acids 8 to 417 (410 residues), 357.8 bits, see alignment E=3.9e-111 TIGR00786: TRAP transporter, DctM subunit" amino acids 16 to 422 (407 residues), 401.6 bits, see alignment E=1.7e-124

Best Hits

KEGG orthology group: None (inferred from 86% identity to pol:Bpro_5095)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>GFF174 TRAP-type C4-dicarboxylate transport system, large permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTTVLGLVFLALMVIGAPIAFAMLIAGLVAVWLKPGLSSLVVMQNLFSGLDSFPLMAIPF
FILAAELMTGGALTDVLLKFAARLVGMRRGGLGHANILTLTFFSGISGSALADAAGPGAM
LIKMMRKAGYKDSYAAALTASTAIVGPIIPPSIIMIVYAMTDNSVSITGLFLAGVVPGFL
IALSLMVVNHIVSVRRGYRSSPELLDPAPLLRLFWRALPALMLPVIILGGIHLGIFTPTE
ASAAAVLYALLVGRFVYGTLRMDMLPAILFRSALMTASILFIVATSAVFAWVLTVGQIPQ
TMAAWIAGMALSPIELLIAINVLLLLVGIFIEPLPGVMIMVPILGPLAEAAGLNSLHFAI
VVIVNLTLGMVTPPVGGLLFVTSAVSGVRMGPMVREMVPMLVALFTVLMLLTFVPAFSTW
LPGVLGYQH