Protein Info for GFF1737 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 51 to 69 (19 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 106 to 133 (28 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 579 to 601 (23 residues), see Phobius details PF20154: LNT_N" amino acids 48 to 196 (149 residues), 81.7 bits, see alignment E=6.8e-27 TIGR00546: apolipoprotein N-acyltransferase" amino acids 81 to 546 (466 residues), 240.8 bits, see alignment E=1.4e-75 PF00795: CN_hydrolase" amino acids 323 to 565 (243 residues), 63.9 bits, see alignment E=1.5e-21

Best Hits

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (611 amino acids)

>GFF1737 Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSRRPPGRSARGSGFAWFLVCLLGGALQAASIAWPLAGWSLPGTVQGQPNGWWQIASLAL
LVLALQYATRVGQAVWRGWVFSTVWLAGTFWWLFISLHTYGGLPAWLAVLAVLALAGLLS
IYYAVVVGFLCAWAPLSRTAQGLMFASLWTLAELARGHWFTGFPWGAGGYAQVDLMAPWA
PLVGVYGMGFLAALLAYSAASLISGAWRRFSVWIQSPVSRPAGRAAGGVRVVAPAPRVQA
RLVPGLADGWPGVLRSLALFLLVGALLVSLLGGGSAWRGLGHRDTAGSGELRVWLLQGNI
AQDQKFEPGTGVAQALNWYPTQIAEAVHAARNSTTGPQLVVAPETAIPLLPGQLGPDFWQ
PLLGQLAEQPAGTGVGALVGLPLGSLEQGYTNSVWGLNSGSAHRLQSLARLDSPDNGLYR
YDKHHLVPFGEFIPPLFRWFTDLMNIPLGDFNRGALAQPAWALAGQRVAPNICYEDLFGE
ELAASFRDPTAAPTVLVNLSNIAWFGDSIAIDQHLHISRLRAIELGRPMLRATNTGATAV
IDHQGQVTHQLQRLTRGRLEASVQGRSGLTPYAQWTARWGLAPLWVGCAVLALLIASTRN
LGRRGGRTRRR