Protein Info for GFF1735 in Sphingobium sp. HT1-2

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 378 (356 residues), 193 bits, see alignment E=3.5e-61

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 72% identity to nar:Saro_3510)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>GFF1735 Hexuronate transporter (Sphingobium sp. HT1-2)
MNEAVAGATQRVGRYRWVVVGLLFAATAINYVDRQMIGVLKPTLAAEMHWSETDYANIVF
WFQAAYAIGYLGFGRLVDAIGARLGYTVAIIIWTIAHVAHGGVHSVTQFAFARFGLGVGE
SGNFPAGIKAVAEWFPQKERAFAIGLFNAGANVGAIITPLLVPWLTIQYGWRFAFIATGI
FGVVWLAAWLIFYRRPQEHPRVGAAELAYIQQDPADPITPIGWRRLIAVRECWAFAIGKF
CIDPIWWFFLFWLPGYLGERYGLDLISFGPPLVAIYLLSDLGSVAGGWLSGRLMKAGHSV
NAARKLTMLVCAAAVTPVFFAQSIDNLWVAVLVIGIATAAHQAFSANLYTLPSDMFPRAA
VGSVVGIGGTAGAIGGMLMAKYAGYILDSIGSYAPLFAVAGSAYFIALLAIHLLSPRLAQ
VKVPE