Protein Info for GFF173 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details PF04290: DctQ" amino acids 33 to 157 (125 residues), 102.6 bits, see alignment E=8e-34

Best Hits

KEGG orthology group: None (inferred from 68% identity to pol:Bpro_5096)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>GFF173 TRAP-type C4-dicarboxylate transport system, small permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSSPPAPSSPAHPLAHAFLAANRWVLIVLLGVMAALVIGNVFARYAFSHSFTWVEEATRY
MMIWAAFIGAGPALRVGGHIAIDTLQASVPLPLARLLRVLIVAIVAATLVTLVWLGIEYV
EFAWYQESPVLGWSLGKVYLALPLGAALMLVHLAMVARQWIVLGEWDRVEGFDPQAL