Protein Info for GFF1725 in Variovorax sp. SCN45

Annotation: Sigma factor regulator VreR (cytoplasmic membrane-localized) of trans-envelope signaling system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 100 to 119 (20 residues), see Phobius details PF16220: DUF4880" amino acids 25 to 63 (39 residues), 30.3 bits, see alignment 3.1e-11 PF04773: FecR" amino acids 134 to 225 (92 residues), 45.9 bits, see alignment E=6.7e-16

Best Hits

KEGG orthology group: None (inferred from 54% identity to put:PT7_0267)

Predicted SEED Role

"Sigma factor regulator VreR (cytoplasmic membrane-localized) of trans-envelope signaling system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF1725 Sigma factor regulator VreR (cytoplasmic membrane-localized) of trans-envelope signaling system (Variovorax sp. SCN45)
MDARPSSSAADSPGHVVDQETILAEARAWARRLRTQQPTTEDAAAFRLWRAQSPAHAHAW
AATASDWRDIGRIAQAYRARYPAPVDRAAPERVMRPGRRLFLGSAMAAAGAAAVAVVVQP
PLGLWPSLSELGADYRTATGEQKQVDLAGGIELALNTQTSLSVKAATEGEGTRVELLAGE
AAVRNRGSAAMEVAAGAGRIWLASGCVEVRRFADHVRVLCTEGEAELRHPSRSVALHARQ
EVSYGREDVGPLAGVESPLASAWRQGVVVFNQTPLPEAVAEINRYRPGRVVLMGQGLAAR
RISGRFRVGALDEALVQMQQLYRLDARHVGGLVLLG