Protein Info for PS417_08760 in Pseudomonas simiae WCS417

Annotation: metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 484 to 503 (20 residues), see Phobius details PF01400: Astacin" amino acids 57 to 160 (104 residues), 27.4 bits, see alignment E=7.3e-10 PF13583: Reprolysin_4" amino acids 108 to 196 (89 residues), 26.7 bits, see alignment E=1.2e-09 PF08548: Peptidase_M10_C" amino acids 222 to 426 (205 residues), 229 bits, see alignment E=1.3e-71 PF00353: HemolysinCabind" amino acids 306 to 340 (35 residues), 26 bits, see alignment 2.2e-09

Best Hits

KEGG orthology group: None (inferred from 76% identity to pfs:PFLU1793)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TW38 at UniProt or InterPro

Protein Sequence (520 amino acids)

>PS417_08760 metalloprotease (Pseudomonas simiae WCS417)
MNNYDLRSRSSLNSVPVADFGPLGVGAGSKPSYTTDQAANQLTRENLRFHDRNGDSKVDV
NYTVDNSFTHQQQGRVRQAVQSWQDVANINFREQASGTDGTLNIRNNPGGDRGVATFPGR
FTTQTSATIGTRRENGAPALGSQFSITAIHEIGHAIGLQHPGNYNGNGFDYLNSAVYAED
TKARTVMSYWSEKNQKGHDFKGQNPSAPMMDDIAAAQRLYGANHQTRNTNTTYGFNSNTE
REAMSLKSAADKPVFCVWDGGGVDTMDFSGFSQDQNINLKAESFSDVGGLKGNVSIAKGC
TIENAIGGSGRDTVSGNEAANRLKGGGGGDTLRGGGGADTFVYDKASDSTPTDPDMIQDF
TSGTDKIDVSGALKGAGLSGLAFTDRFTGRAGEAVLKHDPGTGLSSLAIDLKGTGNADLL
IKSKGAIKPTDVQWGGQAPEVQPAPAPVPTPTPTPTPTPTPTPTPPPVPTPAPSPLPDKA
QEHAAGLIQMFATTLLAFFSQLLSRLTSPSGQASAEKNQS