Protein Info for GFF1721 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ATP synthase F0 sector subunit c (EC 3.6.3.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00137: ATP-synt_C
  • amino acids 11 to 72 (62 residues), 47.7 bits, E=7.8e-17
• TIGR01260: ATP synthase F0, C subunit
  • amino acids 20 to 77 (58 residues), 105.9 bits, E=4.2e-35

Best Hits

Swiss-Prot: 100% identical to ATPL_KLEP7: ATP synthase subunit c (atpE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 100% identity to eco:b3737)

MetaCyc: 100% identical to ATP synthase Fo complex subunit c (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• ATP biosynthesis (1/1 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Protein Sequence (79 amino acids)

>GFF1721 ATP synthase F0 sector subunit c (EC 3.6.3.14) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV
DAIPMIAVGLGLYVMFAVA