Protein Info for GFF1716 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF12625: Arabinose_bd" amino acids 9 to 191 (183 residues), 181 bits, see alignment E=3.9e-57 PF12833: HTH_18" amino acids 240 to 316 (77 residues), 74.1 bits, see alignment E=1.4e-24 PF00165: HTH_AraC" amino acids 281 to 316 (36 residues), 28.7 bits, see alignment 1.6e-10

Best Hits

KEGG orthology group: None (inferred from 71% identity to rfr:Rfer_3834)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF1716 Transcriptional regulator, AraC family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVAAYRERGMDPAGALESAQIPPGKVDQPDARITAAQMEAVSEAAMRELDDEGLGCFSRA
LPWGSYGMLARASLSAPTLGMALRRWCRHHGLITDDVALSLETVSERARLVLRPHRRPGP
LTEFCVVSVLRNIHGLASWYVDSRIPLQGAQFPYAPPSHLDAYAVLFDGPAAFGADEAAI
AFDARYLALPMRRDEAAMNQLLQRALPLTVRSYRRDRLLVQRVRQVLATQPLDAHNADDL
AALLHVSARTLHRQLKDEGASLQTLKDEVRRQRATELLLRTRRPIKQVAQACGFQNEKSF
IRAFRGWTGRSPGDWRGEQLAQLVHVAEHAGHR