Protein Info for GFF1715 in Variovorax sp. SCN45

Annotation: Chromosome (plasmid) partitioning protein ParB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02195: ParB_N" amino acids 95 to 175 (81 residues), 39.7 bits, see alignment E=6.9e-14 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 100 to 273 (174 residues), 111.2 bits, see alignment E=2.5e-36 PF17762: HTH_ParB" amino acids 198 to 277 (80 residues), 25.6 bits, see alignment E=1.8e-09 PF18090: SoPB_HTH" amino acids 200 to 270 (71 residues), 39.8 bits, see alignment E=6.3e-14

Best Hits

KEGG orthology group: K03497, chromosome partitioning protein, ParB family (inferred from 70% identity to vap:Vapar_6109)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParB" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>GFF1715 Chromosome (plasmid) partitioning protein ParB (Variovorax sp. SCN45)
MASTRKRLEALTAGLSIPEQVPAAAPVFAPSTPVPPALPGAAPVAVETRFPPAQTGLPPP
RTGPGQMLAFRGQMQAVEGELAALRERLRQHDGSTPTRKIDPATIRASRWANRHPASFES
AEFAGLKADIELAGGNVQPILVRPLPDEPGQYELVFGHRRHRACLELGIPVLAAIWLDEL
GDAELFAAMDRENRERADLSPYEQGVMYQRALEEQLFPTQRQLAEKLGVSHTWIRKALMV
AQLPSAVLECFRSPLEVQHRHAEQLNAALDKDRRSVLKRAEKVRGMKLAPAAVVARLQGL
EAMAKAEKLTIVNDGRTVGTCLRAPDGTVTLTLTAGAVSSLTPDILLKSVAETLQKVRLL
G