Protein Info for GFF1706 in Xanthobacter sp. DMC5

Annotation: Spermidine/putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13531: SBP_bac_11" amino acids 32 to 279 (248 residues), 43.6 bits, see alignment E=6.3e-15 PF01547: SBP_bac_1" amino acids 39 to 278 (240 residues), 66.4 bits, see alignment E=9.1e-22 PF13416: SBP_bac_8" amino acids 42 to 307 (266 residues), 87.6 bits, see alignment E=2.6e-28 PF13343: SBP_bac_6" amino acids 92 to 292 (201 residues), 67.5 bits, see alignment E=2.6e-22

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 94% identity to xau:Xaut_2577)

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>GFF1706 Spermidine/putrescine-binding periplasmic protein (Xanthobacter sp. DMC5)
MNGKIVALGLALAAFVAGPASAAEKLVVSTWGGSFRDLIAEAIASKFTKDTGVEVEYITG
GTIDRLNKAKLAKGSPESDITFTTAHVGWLYANDDLFETLDLSKMPNASKLVPQAKVSPY
HIGAWAYVYTIGYRPDLTPKNINFSSWADLWNPELKGMLAAPDFDPSHIIAVSALLAGGS
PADWQKGEQKLLALKPNFKAFYTNDANSQQLIATGETPVQIMLSMNAYYMIAQGVPIKLV
IPKEGGVLGIDTMAIMKGSKNRELAEKFINTALDPEVQGKIAELKKGSPTVLGAKVSAET
AKLPGVFTTAEQWDKETIIIDHKLRAEKTAEWRKWFSENMIAK