Protein Info for GFF1705 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 59 to 84 (26 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 146 to 172 (27 residues), see Phobius details amino acids 193 to 219 (27 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 267 (184 residues), 44.1 bits, see alignment E=9.9e-16

Best Hits

KEGG orthology group: None (inferred from 92% identity to xau:Xaut_2578)

Predicted SEED Role

"ABC-type transporter, permease component: POPT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>GFF1705 hypothetical protein (Xanthobacter sp. DMC5)
VNKRPFLALFVAPATLAAIASAAALAAILQYAFRAYVPGSLNPGGLTLDNFFALLRPLYA
QVFIQTVWICLLTALITLVVAYPLAYALVRTRNVALKSFLLITAVTPLFLGEVVRTYSWI
IVLGNTGFINSVLKGVGLIDRPVQMMFTTFGVVTALVHVTLPVMVIMLSAALSHIDRDYE
KAATSLGAGPVKAFLTVTLPLSMPGVVAGVSTAFAWTFSAFATPQMIGGGKVSMISTLVY
QLGFASFNFPFAAALSVTGLALTFAVLAMAKQAIKPLEKIGAH