Protein Info for GFF1702 in Pseudomonas sp. DMC3

Annotation: Transcriptional regulatory protein RstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF00072: Response_reg" amino acids 17 to 125 (109 residues), 87.4 bits, see alignment E=7.5e-29 PF00486: Trans_reg_C" amino acids 161 to 236 (76 residues), 87.3 bits, see alignment E=6e-29

Best Hits

Swiss-Prot: 47% identical to RSTA_ECOLI: Transcriptional regulatory protein RstA (rstA) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 95% identity to pfo:Pfl01_3391)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF1702 Transcriptional regulatory protein RstA (Pseudomonas sp. DMC3)
MFGLATVVMENLGFGKVLLVEDDERLAALIAHFLEQHGYEVRTVHRGDLAMAAFLEFKPK
VLVLDLMLPGQSGLQVCREIRSVSDTPIVILTAKEDDLDHILGLESGADDYVIKPIKPPV
LLARLRALQRRQTPDSSVVSFLEFGQLNIDRSCREVRLTGELIELTTMEFELLWLLASAA
GKILSRDDILNRMRGIAFDGLNRSVDVYISKLRNKLKDNPREPVCIKTVWGKGYLFNPFA
WEL