Protein Info for GFF1702 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00392: GntR" amino acids 18 to 77 (60 residues), 65.7 bits, see alignment E=3.6e-22 PF07729: FCD" amino acids 108 to 225 (118 residues), 83.2 bits, see alignment E=3.1e-27

Best Hits

Swiss-Prot: 86% identical to YIEP_ECOLI: Uncharacterized HTH-type transcriptional regulator YieP (yieP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sek:SSPA3480)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>GFF1702 Transcriptional regulator, GntR family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPLSAQQLAAQKNLSYVLAEKLAQRILKGDYAPGTILPGEIELGEQYGVSRTAVREAVKT
LTAKGMVLPRPRIGTRVMPQGNWNFLDQELLTWWMTEENFHQVVEHFLVMRISLEPQACL
LAATLGTPEQKARLNALMEEMVALKKHFKRERWIEVDMAWHEHIYEMSANPFLISFATLF
HSVYHTYFTSITYNEVVKLDLHQAIVDAIADGDGERAFQACQALLIAPNERPDN