Protein Info for PS417_00085 in Pseudomonas simiae WCS417

Annotation: 16S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 1 to 123 (123 residues), 89.5 bits, E=2.6e-29
• TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • amino acids 7 to 430 (424 residues), 411.9 bits, E=1.9e-127
• PF01189: Methyltr_RsmB-F
  • amino acids 238 to 428 (191 residues), 205.8 bits, E=5.9e-65

Best Hits

Swiss-Prot: 87% identical to RSMB_PSEPK: Ribosomal RNA small subunit methyltransferase B (rsmB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 98% identity to pfs:PFLU0016)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A1N7U2S5 at UniProt or InterPro

Protein Sequence (436 amino acids)

>PS417_00085 16S rRNA methyltransferase (Pseudomonas simiae WCS417)
MNPRLAAAKALAAVLSGKASLNSSLPTQLDKVEDRDRGFTQDLAFGTARWQPRLSALAAT
LLQKPFKAADADVEALLLVGLYQLLYTRVPAHAAIGETVGCADKLKKPWAKALLNAVLRR
AQRESEALLAELEHDPVVRTAHPRWLQKSLKAFWPEQWEAICAANNAHPPMILRVNRRHH
SRDAYLQLLTDAGIGATPCVYSVDGIVLEAATDVRSLPGFAEGWISVQDEAAQLAADLLD
LAPGQRVLDACCAPGGKTCHILEVEKDLVGVVAVDLEAKRLVRVRENLARLGLSAELIAA
DGRDTATWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQPDDIAALAVLQGELLDALWP
TLEVGGILLYATCSTLPTENTEVIEAFLARTSGARELDLATTAGIRQPHGRQLLAQEGGH
DGFYYAKLIKIAAARG