Protein Info for GFF17 in Pseudomonas sp. DMC3

Annotation: Anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF02885: Glycos_trans_3N" amino acids 5 to 66 (62 residues), 78 bits, see alignment E=3.6e-26 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 8 to 337 (330 residues), 405.9 bits, see alignment E=7e-126 PF00591: Glycos_transf_3" amino acids 76 to 329 (254 residues), 329.2 bits, see alignment E=2e-102

Best Hits

Swiss-Prot: 96% identical to TRPD_PSEPF: Anthranilate phosphoribosyltransferase (trpD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 96% identity to pfo:Pfl01_5114)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF17 Anthranilate phosphoribosyltransferase (Pseudomonas sp. DMC3)
MNIKTALSRIVEHLDLSTDEMRDVMREIMTGQCTEAQIGAFMMAMRMKSESIDEIVGAVS
VMRELADQVELKTLDGVVDVVGTGGDGANIFNVSTASSFVVAAAGCTVAKHGNRAVSGKS
GSADLLEAAGIYLNLTPVQVARCIDNVGIGFMFAQTHHKAMKYAAGPRRELGLRTLFNML
GPLTNPAGVKHQVVGVFTQTLCRPLAEVLQRLGSKHVLVVHSKDGLDEFSLAAPTFVAEL
KNNEITEYWVEPEDLGMKSQSLHGLSVEGPEASLALIRDALGKRKTENGQKAAEMIVLNA
GAALYAADLASSLKQGVELAHDALHTGLAREKLEELGAFTAVFKVENEG