Protein Info for GFF1696 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable MFS transporter precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 89 to 116 (28 residues), see Phobius details amino acids 118 to 130 (13 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 246 to 276 (31 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 342 (315 residues), 107.4 bits, see alignment E=7.4e-35 PF00083: Sugar_tr" amino acids 53 to 192 (140 residues), 39.6 bits, see alignment E=3.3e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF1696 Probable MFS transporter precursor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSEHPLPPTGALPHHPPAEARLGLVAIFGSTFFELVGYFMLTPLLLLRLKGGGESTALAG
VFAASGWLGVFFMTPFASAITQRLGRRPTLWLAALIPVIATAGFAFTPLLWLWFVFKIAA
GMASGLRWVLAEAVVAEFSPPGQRGRYVGIFETMVGITFVVGPLMLAWVGADSDAALWIA
LGFMAIGLVWSLLIPRLPDAADAHSAKVGLSGVWHALLAHPLIMTVGFVGGFFESGLTSI
LPLYGLALGLGATVSALLVSASGLGSALMMLPAGVLADRMAHHPAQRWGDGHRARLAIMR
VCALITLLATLVIPFVAGTPWLAAPVAFLWGGAGGCLYTLAMIDIGSREEGITLVNSTAV
LVLSYTLGGVLAPALGAAALQWAPTLGFPALLLSVAGVGWWLLRRTVSAPSEGTPRG