Protein Info for GFF1694 in Variovorax sp. SCN45

Annotation: Na+/H+-dicarboxylate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 336 to 353 (18 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details PF00375: SDF" amino acids 16 to 408 (393 residues), 383.7 bits, see alignment E=5.1e-119

Best Hits

Swiss-Prot: 88% identical to DCTA2_CUPMC: C4-dicarboxylate transport protein 2 (dctA2) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 96% identity to vpe:Varpa_0732)

MetaCyc: 71% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF1694 Na+/H+-dicarboxylate symporter (Variovorax sp. SCN45)
LDHQPRPVPKPFYKSLYFQVITAIVLGVLLGHFYPDTGASMKPLGDGFIKLIKMIIAPII
FCTVVVGIAGMEDMKKVGKTGGLALLYFEIVSSIALVVGLVIINIVRPGAGMNVDVSQLD
TKSIAAYTGPGKMQSTTDFVLNIIPNTLVDAFAKGEILQVLLIAVMFGFALHRFGGRGTL
VFDVIEKGSHVLFVIVGYIMKVAPIGAFGAMAFTIGKYGVSSLLQLGQLMATFYITCLLF
IFVVLGGIARFHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMAKLENLGAKKSVVGLV
VPTGYSFNLDGTSIYLTMAAVFIAQATNTDMTLTQQLTLLAVLLLTSKGAAGVTGSGFIV
LAATLSAVGHVPVAGLALILGIDRFMSEARALTNLIGNGVATLVVAKWTGDLDTVRMHQH
LNQESAAEADEPERVLDATETHMPAGSVR