Protein Info for GFF1691 in Variovorax sp. SCN45

Annotation: Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF06490: FleQ" amino acids 8 to 121 (114 residues), 22.1 bits, see alignment E=6.2e-08 PF00072: Response_reg" amino acids 9 to 118 (110 residues), 93.9 bits, see alignment E=3e-30 PF00158: Sigma54_activat" amino acids 148 to 314 (167 residues), 223.2 bits, see alignment E=6.7e-70 PF14532: Sigma54_activ_2" amino acids 149 to 319 (171 residues), 62 bits, see alignment E=3.1e-20 PF07728: AAA_5" amino acids 171 to 290 (120 residues), 28.5 bits, see alignment E=5.6e-10 PF25601: AAA_lid_14" amino acids 320 to 377 (58 residues), 63.4 bits, see alignment 5.8e-21 PF02954: HTH_8" amino acids 405 to 445 (41 residues), 34.5 bits, see alignment 5.3e-12

Best Hits

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 92% identity to vpe:Varpa_0736)

Predicted SEED Role

"Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>GFF1691 Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake (Variovorax sp. SCN45)
VSDDPAIRVLLVEDDEDVRLSTTQVLTLAGFEVEAFASAERARAHISFGVPAIVISDVRL
PGMSGTEWLGELHTADAELPVILVTGHGHIAMAVQAMREGAYDFIEKPFSSERLVAIVRH
AIERRQLTLQVRTLRDALENWNGIQSVLIGRSAQMQQVRRTVMTLAETSADVLIYGETGT
GKELVAQCLHAHSERRRRHFVPLNCGGLPEALAESELFGHEAGAFTSANRARVGKFEYAN
GGTLFLDEIESMPMPVQIKLLRALQERSIERIGSNKAIPFDCRVVAASKEDLKEMSDRQK
FRADLYYRLGVAFIELPPLRERREDIPLLFEHFTLLAANRYERAAQPLTNAQLADLMAYA
WPGNVRELRNVADRFVLGLLGERLTQTRGTGEGLPALPRALPQQVEAFERAVIVEALRKH
KGDQPATAAALAIARQTLHDKLRKFDILADDFK