Protein Info for GFF169 in Variovorax sp. SCN45

Annotation: Protein-glutamate methylesterase (EC 3.1.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF01339: CheB_methylest" amino acids 15 to 189 (175 residues), 172.6 bits, see alignment E=3.3e-55

Best Hits

Swiss-Prot: 44% identical to CHEB2_LEPIN: Putative protein-glutamate methylesterase/protein-glutamine glutaminase (cheB2) from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 83% identity to vpe:Varpa_2957)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>GFF169 Protein-glutamate methylesterase (EC 3.1.1.61) (Variovorax sp. SCN45)
MKRRLRSTNKRVEAVVLGASAGGIDALTTLLHDLPATWHIPMAVVLHLPEEHDSHLAEIF
GQRLPIQVLEAADKMPLSAGSLYFAPPGYHLSIERERAFSLSCEPPVLFSRPSIDVLMSS
AADAYGPALAGFLLTGANYDGAEGLHRIHLAGGLTAVQEPTEAQIPTMPQAAIARHAPDY
VLPLRELRALLLQLEAAHEH