Protein Info for GFF1689 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phenylacetate-CoA oxygenase/reductase, PaaK subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF00970: FAD_binding_6" amino acids 27 to 111 (85 residues), 39.8 bits, see alignment E=7.7e-14 PF00175: NAD_binding_1" amino acids 124 to 231 (108 residues), 60.7 bits, see alignment E=3e-20 PF00111: Fer2" amino acids 284 to 357 (74 residues), 60 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: K02613, phenylacetic acid degradation NADH oxidoreductase (inferred from 54% identity to rpf:Rpic12D_3491)

Predicted SEED Role

"Phenylacetate-CoA oxygenase/reductase, PaaK subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>GFF1689 Phenylacetate-CoA oxygenase/reductase, PaaK subunit (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTAARFHELPIARISPEAAGAVAITFAVPPEHRAAFAFEPGQFLTVRATIDGQDVRRSY
SISSPRSLLTQRGELTLGIRPVDGGVFSNWAATQLKAGDTLRAMPPDGRFTIHKPRAVHR
VGFAAGSGITPILSLIASTLEESPTSKFTLVYGNRRMGSVMFNEALQDLKDRYADRLTLI
HILSRQAQEVPLLEGRIDADKVRALIDTLLPVGSMDEVFICGPEAMIEATEKALLDAGVR
PDRVHTERFTSPTLEALPAAQRRAAVLGQPAVRAEGEVELTVVLDGKPHPLRMNRDERVL
DVALNAGLDLPWSCRGGVCCTCRAKVMEGAVQMDKNFTLEPWETDKGFVLSCQARPTTDR
VVVSYDER