Protein Info for GFF1688 in Xanthobacter sp. DMC5

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF00578: AhpC-TSA" amino acids 5 to 137 (133 residues), 48.4 bits, see alignment E=8.8e-17 PF08534: Redoxin" amino acids 5 to 157 (153 residues), 127.9 bits, see alignment E=2.7e-41

Best Hits

Swiss-Prot: 40% identical to MALF3_MALFU: Putative peroxiredoxin (Fragment) from Malassezia furfur

KEGG orthology group: None (inferred from 95% identity to xau:Xaut_2596)

Predicted SEED Role

"Peroxiredoxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF1688 Peroxiredoxin (Xanthobacter sp. DMC5)
MPISVGDKLPNATFRVPTEDGPVPKTTDEIFKGKKVVLFAVPGAFTPTCHKNHLPGYVHE
ADAIKAKGVDAIAVVSVNDPFVMGAWEKASGSDGKIVFLADPDASFAAALDLTFDGSAAG
LGVRSKRYSMVVEDGVVKTLNVEDVPSKADASGATALLAQL