Protein Info for GFF1682 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LSU ribosomal protein L13p (L13Ae)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01066: ribosomal protein uL13
  • amino acids 6 to 142 (137 residues), 198.2 bits, E=2.6e-63
• PF00572: Ribosomal_L13
  • amino acids 14 to 132 (119 residues), 151.2 bits, E=6.7e-49

Best Hits

Swiss-Prot: 94% identical to RL13_VARPS: 50S ribosomal protein L13 (rplM) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02871, large subunit ribosomal protein L13 (inferred from 94% identity to pol:Bpro_4113)

MetaCyc: 64% identical to 50S ribosomal subunit protein L13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L13p (L13Ae)" in subsystem Ribosome LSU bacterial

Protein Sequence (143 amino acids)

>GFF1682 LSU ribosomal protein L13p (L13Ae) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTKTFSAKPADVTHEWFVIDATDKVLGRVASEVALRLRGKHKAIYTPHVDTGDFIVIINA
AKLRVTGNKALDKVYYRHSGFPGGIYGTNFRDMQAKHPGRALEKAVKGMLPKGPLGYAMI
KKLKVYGGAEHPHTAQQPQVLEL