Protein Info for GFF1676 in Xanthobacter sp. DMC5

Annotation: 50S ribosomal protein L25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR00731: ribosomal protein bL25, Ctc-form" amino acids 7 to 184 (178 residues), 131.9 bits, see alignment E=1e-42 PF01386: Ribosomal_L25p" amino acids 8 to 94 (87 residues), 87.5 bits, see alignment E=6.6e-29 PF14693: Ribosomal_TL5_C" amino acids 103 to 186 (84 residues), 83.2 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 84% identical to RL25_XANP2: 50S ribosomal protein L25 (rplY) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 84% identity to xau:Xaut_2607)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>GFF1676 50S ribosomal protein L25 (Xanthobacter sp. DMC5)
MTAIKELKAVARPRAGKGAARAERRAGRVPAVIYGEKQDPITISLDFIEINKIIYAGHFL
TTLFEVDVDGTKHRVIPRDYQLDVVKDFPVHVDFLRVSKGTTVTVDVPVHFVKQEASPAL
KAGGTLNVVAHTVELECPAESIPEAIEVDLTGAAYGDAFHLSSQKLPAGVTWAGQGDDTL
ATIVAPVGAEEEPAAEEPKA