Protein Info for GFF1671 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cobalt-zinc-cadmium resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 12 to 13 (2 residues), see Phobius details transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 13 to 295 (283 residues), 207.1 bits, see alignment E=1.7e-65 PF01545: Cation_efflux" amino acids 15 to 209 (195 residues), 159.3 bits, see alignment E=1.1e-50 PF16916: ZT_dimer" amino acids 223 to 295 (73 residues), 42.3 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: None (inferred from 76% identity to rfr:Rfer_0729)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF1671 Cobalt-zinc-cadmium resistance protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRFVPARFLTPRRLLMASIGVAVATIVLKTLAWVVTDSVGLLSDAMESLVNLASAVVGLV
MVTIAARPADEDHPYGHHKAEYFSSGFEGILIIAAGLGILWAAGSRLMNPQPIEQVGWGL
ALSVASSVLNGGLAWTMLQASKTHRSIALEADAKHLFSDVWTSAGVLVGVVLVAFTGWLW
LDPLVAMAVALNILKEGARLAWRSSQGLMDEAVEPEVMAAIQQTLEGFALSHGPTHIIRF
DHVSTRRAGQRRFVDLHMHMPAGWTLGRAAAVRGSVEQALMSAVPGLRATIQLLPSDVEA
HFFDEDDLK