Protein Info for GFF1667 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphate starvation-inducible protein PhoH, predicted ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF02562: PhoH" amino acids 89 to 292 (204 residues), 323.7 bits, see alignment E=6.3e-101 PF13604: AAA_30" amino acids 94 to 245 (152 residues), 33.1 bits, see alignment E=7.2e-12 PF13245: AAA_19" amino acids 101 to 245 (145 residues), 27.3 bits, see alignment E=5.4e-10

Best Hits

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 80% identity to pol:Bpro_4095)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF1667 Phosphate starvation-inducible protein PhoH, predicted ATPase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAHLCGPMDSHIRSIEAALQVKVAHRFEQFRIEGPKAKATQALETLQALYEMAKRPIPAE
QVQLMLSGDTALADPGDGALAMQTRRGEVRGRTPNQARYLENMATHDITFGIGPAGTGKT
YLAVACAVDALERSAVQRIVLTRPAVEAGEKLGFLPGDLGQKVDPYLRPLYDALYDLMGA
DKVQKAFERQQIEIAPLAFMRGRTLNHAFVILDEAQNTTVEQMKMFLTRIGFGSKAVVTG
DVSQIDLPRTQLSGLIDAERVLKRVQGIAFTRLSSADVVRHPLVARIVDAYDARTPDADA
APPPKRARRAAH