Protein Info for GFF1667 in Methylophilus sp. DMC18

Annotation: Type II secretion system protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 167 to 189 (23 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details PF00482: T2SSF" amino acids 67 to 190 (124 residues), 101.2 bits, see alignment E=2.1e-33 amino acids 270 to 392 (123 residues), 88.8 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: K12278, MSHA biogenesis protein MshG (inferred from 61% identity to meh:M301_1282)

Predicted SEED Role

"MSHA biogenesis protein MshG" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF1667 Type II secretion system protein F (Methylophilus sp. DMC18)
MPLFEYKGRTEDGMMVTGVQEAADADALGAALIGTRITPIEIKPKKTSGVAINLFEEKIT
SLEVMIFSKQMYTLLKAGIPIMRALSGIQSSVGNPKLAQVVGQLRVSLDSGRELSVAMTE
HPKVFDSFYISMIRVGETTGNLDNIFLRLSEHIEFDRFMRGQIKSALQYPMFVLTAMAIA
IVVINVMVIPQFEKVFASMHADLPMITKMLIAFSNFMRNYWFVLIGMIAAAGWSFKTYVK
TASGRSNWDRIKMRIPIAGKIIFKGTMARFARSFALSTRSGLPILSALRLVSQTVENDYI
SAKILSMSAGIERGETILRTATQTGVFNSLVLQMIAVGEESGSLDTLMQEIADMYQADVE
YDVKTLGAQIEPILIMFLGALVLVLALGVFLPIWDMSSVMLKGG