Protein Info for GFF1665 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Holliday junction DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF05496: RuvB_N" amino acids 31 to 189 (159 residues), 274.6 bits, see alignment E=6.8e-86 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 35 to 337 (303 residues), 493.3 bits, see alignment E=1.1e-152 PF07728: AAA_5" amino acids 65 to 183 (119 residues), 31 bits, see alignment E=7.3e-11 PF00004: AAA" amino acids 66 to 188 (123 residues), 75.2 bits, see alignment E=2.1e-24 PF17864: AAA_lid_4" amino acids 192 to 265 (74 residues), 111.3 bits, see alignment E=4.5e-36 PF05491: WHD_RuvB" amino acids 267 to 336 (70 residues), 84.8 bits, see alignment E=9.8e-28

Best Hits

Swiss-Prot: 90% identical to RUVB_POLSJ: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 90% identity to pol:Bpro_4093)

MetaCyc: 72% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GFF1665 Holliday junction DNA helicase RuvB (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSIQTDDFTPAPRVVSAAPASPKEEAIERALRPKLLDEYVGQTKVREQLEIFIGAAKKRS
EALDHVLLFGPPGLGKTTLSHIIAQELGVNLRQTSGPVLEKPKDLAALLTNLEANDVLFI
DEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSIKLDLQPFTLVGATTRAGMLTNPLR
DRFGIVARLEFYTSEELARIVKRSAGLLNAPMEDEGGFEIARRSRGTPRIANRLLRRVRD
FAEVKGRGVITQDIANRALAMLDVDPQGFDLMDRKLLEAVIHRFDGGPVGLDNIAASIGE
ERDTIEDVIEPYLIQQGFLQRTPRGRIATLAAYRHLGVAPPSNAGELFAD