Protein Info for GFF1664 in Xanthobacter sp. DMC5

Annotation: Bicarbonate transport ATP-binding protein CmpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00005: ABC_tran" amino acids 35 to 174 (140 residues), 97.7 bits, see alignment E=9.4e-32

Best Hits

Swiss-Prot: 46% identical to CMPD_SYNY3: Bicarbonate transport ATP-binding protein CmpD (cmpD) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 86% identity to xau:Xaut_2619)

Predicted SEED Role

"Cyanate ABC transporter, ATP-binding protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF1664 Bicarbonate transport ATP-binding protein CmpD (Xanthobacter sp. DMC5)
MENAKTESYPKFISIEGIARRYPAPGGGSTTIFEDLWLPVQRGEFVCIIGHSGCGKTSVL
NILAGLEEPSDGVVVVDGQAISGPSLDRAVIFQGHALLPWKSVIGNVGYAVSSRWRKAGR
AEVEERARRFIDLVGLKGNELKRPAELSGGMRQRVGIARALSIEPKILLMDEPFSALDAL
TRGTLQDEVRRICKSTGQTVVMITHDVDEAIYLADKIVLMTNGPEAMIAEVVENPLPMER
ARDSIHREENYYAVRNHLVDFLVSRSRTFKAEMPAGYDRRHPPVVRLGRPPEPAPANTIP
FPVIASARD