Protein Info for GFF1664 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sterol desaturase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 162 to 194 (33 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details amino acids 411 to 429 (19 residues), see Phobius details amino acids 438 to 456 (19 residues), see Phobius details amino acids 461 to 482 (22 residues), see Phobius details amino acids 490 to 509 (20 residues), see Phobius details amino acids 517 to 536 (20 residues), see Phobius details amino acids 543 to 563 (21 residues), see Phobius details amino acids 574 to 593 (20 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 112 to 245 (134 residues), 104.1 bits, see alignment E=8.2e-34 PF07947: YhhN" amino acids 408 to 591 (184 residues), 150.8 bits, see alignment E=3.4e-48

Best Hits

KEGG orthology group: None (inferred from 71% identity to vpe:Varpa_5280)

Predicted SEED Role

"Sterol desaturase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>GFF1664 Sterol desaturase-related protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRVDAKGENTGFCPQCAHASLAPPTPPMSPNQIIVLATPVFFALIAVEYAIGLKRRRNTY
RLDDAITSIGLGMLSQISAVFTRLLRVGLYTAVYSAVAIWPDHPFWTSWAGWLTALVFYD
FCYYWLHRAGHESAVFWAAHVVHHQSQDYNLSTALRQTSSGALLGWLFYLPMAVAGVPPL
VFGVVALIDLLYQFWVHTEQVGKLGWFDRWFCSPSNHRVHHAVNDRYLDRNYGGILIVWD
RLFGSFREEDEKCVYGTRKPLQSWDPLWANGEVYWGLLRDSWHTRRWADKLRVWLKPPGW
RPADVAARFPAPTFDLAGVQRYAPPMSAAVRWFAGAQFVALLAGVAVFLWFADAWPLSRS
AVVFSVLLVALWAIGAVMQGRIGMGEALLIECGALAMATAALGWLELHRVFKPLAMLIAM
AVVGAHARGAGGVRRADALLLAALALSLAGDVFLMLSGYFIPGLVAFLLAHLAYIALFRL
GLPWFPSRRALAATLGLGVAMYSFLWLGGLPAGLRAPVAAYVLVIALMAAQAIGRAAAHR
DRAALAVALGAGFFMLSDSLLATNKFVSPLPMSQVWVLSTYYAAQVLIVAGMLRGRRDGA
EPATLTGWPAARSSLADGHPR