Protein Info for GFF1663 in Xanthobacter sp. DMC5

Annotation: Cyanate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF21291: CYNS_N" amino acids 3 to 72 (70 residues), 47.5 bits, see alignment E=1.4e-16 TIGR00673: cyanase" amino acids 5 to 148 (144 residues), 140.8 bits, see alignment E=1.6e-45 PF02560: Cyanate_lyase" amino acids 79 to 146 (68 residues), 117.7 bits, see alignment E=1.6e-38

Best Hits

Swiss-Prot: 55% identical to CYNS_METPP: Cyanate hydratase (cynS) from Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 99% identity to xau:Xaut_2620)

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>GFF1663 Cyanate hydratase (Xanthobacter sp. DMC5)
MKREQLTEKLLDIKREKGWTWKYICGEIGGMSPVLVVGALLGQMKLVKPLAKKAAELFGL
SEVEERMLNEVPMRGAGTPMPPTDPLIYRFYELVMVNGPAWKALIEEEFGDGIMSAIDFN
MEMVREPNPKGDRVQITMSGKFLPYKYYGNEQGIPDYGFKES