Protein Info for GFF1661 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar biosynthesis protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 78 to 117 (40 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 188 to 214 (27 residues), see Phobius details PF01312: Bac_export_2" amino acids 7 to 347 (341 residues), 429.2 bits, see alignment E=6e-133 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 7 to 354 (348 residues), 464.5 bits, see alignment E=1.2e-143

Best Hits

Swiss-Prot: 100% identical to FLHB_SALTY: Flagellar biosynthetic protein FlhB (flhB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 99% identity to sed:SeD_A1331)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>GFF1661 Flagellar biosynthesis protein FlhB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VAEESDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAGM
LSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSGKS
LQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAESPI
VAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDPHV
KGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIALR
IREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQR
PPQPENLPVPEALDFMNEKNTDG