Protein Info for GFF1657 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Penicillin-binding protein 2 (PBP-2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details TIGR03423: penicillin-binding protein 2" amino acids 15 to 611 (597 residues), 738.8 bits, see alignment E=2.3e-226 PF03717: PBP_dimer" amino acids 60 to 233 (174 residues), 155.7 bits, see alignment E=1.9e-49 PF00905: Transpeptidase" amino acids 268 to 607 (340 residues), 223.1 bits, see alignment E=5e-70

Best Hits

Swiss-Prot: 100% identical to MRDA_SALTY: Peptidoglycan D,D-transpeptidase MrdA (mrdA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05515, penicillin-binding protein 2 (inferred from 99% identity to sec:SC1917)

MetaCyc: 59% identical to peptidoglycan DD-transpeptidase MrdA (Escherichia coli K-12 substr. MG1655)
Serine-type D-Ala-D-Ala carboxypeptidase. [EC: 3.4.16.4]

Predicted SEED Role

"Penicillin-binding protein 2 (PBP-2)" in subsystem Peptidoglycan Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (623 amino acids)

>GFF1657 Penicillin-binding protein 2 (PBP-2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTFKDFDAEEKLFLRRVIVAFGVVVVCFGILIFNLYNLQIRQHHYYTTRSNENDIKMLPV
APTRGIIYDRNGIPLVRNVTWYDIAVTPYKIADMDALLKQLTPIVDLSPDDISDFRRALK
SSSRYRPVVLKNALTDVEIARFAVNQFHFNGVTINSYQDRQYPYGAELAHVLGYVSKIND
NDLKALDKKGLAENYAADHNIGKQGIERYYENDLHGKTGYQEVEVDNHGRIVRLLKDVPP
IAGKNIHLTLDLHLQEYIESLLAGQRAAVLVEDPHDGSVLAMVSMPSYDPNPFVKGISYQ
DYGKLLHDKNLPLINRVTQGLYPPASTVKPYMAMSALLCGIITPQTTFFGAPTWTLPGTQ
RHYRDWKKTGHGMLDVTKAIEESADTFFYQVAYMMGIDRIDTMLSQFGYGKPTGIDLNEE
YDGLLPSRAWKQRVHKKAWYQGDTISVGIGQGYWIATPIQMVKAMVALINNGKVIAPHLL
LNEESGKTVVPYRPSGTPAQIADPASPYWGLVRQAMYGMANAPNGTGYKFFHTAPYGIAA
KSGTSQVFSLKENQTYNAKMIPIRLRDHVFYTAFAPYKNPKVAIALILENGGSDGVTAAP
IMRKILDHLFDPQADTTQPDQAP