Protein Info for GFF1655 in Pseudomonas sp. DMC3

Annotation: Protein DipZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 117 to 143 (27 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details PF02683: DsbD_TM" amino acids 2 to 167 (166 residues), 31.9 bits, see alignment E=2.1e-11 PF13386: DsbD_2" amino acids 4 to 199 (196 residues), 25.2 bits, see alignment E=3.7e-09 PF00578: AhpC-TSA" amino acids 271 to 376 (106 residues), 50.8 bits, see alignment E=4e-17 PF08534: Redoxin" amino acids 271 to 382 (112 residues), 47.6 bits, see alignment E=4e-16 PF13905: Thioredoxin_8" amino acids 279 to 373 (95 residues), 42.7 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_2089)

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF1655 Protein DipZ (Pseudomonas sp. DMC3)
MYLIAFLGGLLTVLSPCILPVVPFLFAGANRTRSSILLTLAGMALTFALISSLAVVSSEW
VIQASNTGRHFALLVMALFALSLISARVGDWLTRPFVALGNRLDQDTRKRAGPMGSIMLG
VATGLLWAPCAGPILGVILTGAMLQGANAQTSLLLLAYGVGSALSLGTLIFAGRGLVNRL
KPSIPFSGWLRRGAGVAVLATVAVISTGADKTLLANTSSEGVASVEKNVLENVPKVVDYF
VSKVRADSMMDEARGAMPSLSGAVQWLNSPELSAESLRGKVVLVDFWTYDCINCQHTLPY
VKDWAKKYEKDGLVVIGVHTPEYGYERIINNVKDQVKKLGITYPVAIDNDYAIWRNFDNQ
YWPAHYLIDAKGQMRYSHFGEGRYAEQEQMIKQLLEEAKAPAA