Protein Info for GFF1652 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details PF00034: Cytochrom_C" amino acids 73 to 170 (98 residues), 38.7 bits, see alignment E=1e-13

Best Hits

Swiss-Prot: 61% identical to CYCM_BRADU: Cytochrome c homolog (cycM) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K08738, cytochrome c (inferred from 91% identity to xau:Xaut_2631)

Predicted SEED Role

"membrane c-type cytochrome cy" in subsystem Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>GFF1652 hypothetical protein (Xanthobacter sp. DMC5)
MDSFELNKIAGAVLGTLTLTLGLGIVSEILFTPEAPAKPGFEIAVQEGAAAAGAPKAAAE
VPIEQLFATASIEKGAAAAKKCAACHNFQEGAGAKVGPDLYGIVGRPVASAAGFAYSAAM
KAKGGDWTALALNTFLTNPKAAVPGTAMAFAGIGKEAERADLIAYLNSLSHDPKPLPTAA
AAPAAAPAAAPAAAPAGHK