Protein Info for GFF1652 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: tRNA (5-methoxyuridine) 34 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08003: Methyltransf_9
  • amino acids 7 to 322 (316 residues), 568.5 bits, E=8.5e-175
• TIGR00452: tRNA (mo5U34)-methyltransferase
  • amino acids 7 to 321 (315 residues), 492 bits, E=2.7e-152
• PF13489: Methyltransf_23
  • amino acids 112 to 267 (156 residues), 37.2 bits, E=6.1e-13
• PF13847: Methyltransf_31
  • amino acids 123 to 228 (106 residues), 30.1 bits, E=8.8e-11
• PF13649: Methyltransf_25
  • amino acids 126 to 204 (79 residues), 29.7 bits, E=2.2e-10
• PF08241: Methyltransf_11
  • amino acids 127 to 223 (97 residues), 25.7 bits, E=3.7e-09

Best Hits

Swiss-Prot: 100% identical to CMOB_SALTY: tRNA U34 carboxymethyltransferase (cmoB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to sew:SeSA_A2060)

MetaCyc: 93% identical to tRNA U34 carboxymethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-7067

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

MetaCyc Pathways

• 5-(methoxycarbonylmethoxy)uridine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (323 amino acids)

>GFF1652 tRNA (5-methoxyuridine) 34 synthase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIEFGNFYQLIAKNHLSHWLETLPAQIASWQREQQHGLFKQWSNAVEFLPEMTPWRLDLL
HSVTAESETPLSEGQLKRIDTLLRNLMPWRKGPFSLYGVDIDTEWRSDWKWDRVLPHLSD
LTGRTILDVGCGSGYHLWRMIGAGAHLAVGIDPTQLFLCQFEAVRKLLGNDQRAHLLPLG
IEQLPALKAFDTVFSMGVLYHRRSPLEHLWQLKDQLVNEGELVLETLVIDGDENTVLVPG
DRYAQMRNVYFIPSAPALKKWLEKCGFIDVRIADVCVTTTEEQRRTEWMVTESLADFLDP
NDRSKTVEGYPAPQRAVLIARKP