Protein Info for GFF1647 in Xanthobacter sp. DMC5

Annotation: Inner membrane ABC transporter permease protein YejE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 57 to 78 (22 residues), see Phobius details amino acids 203 to 228 (26 residues), see Phobius details amino acids 248 to 281 (34 residues), see Phobius details amino acids 318 to 345 (28 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 218 to 399 (182 residues), 96.8 bits, see alignment E=6.6e-32

Best Hits

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 94% identity to xau:Xaut_2635)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>GFF1647 Inner membrane ABC transporter permease protein YejE (Xanthobacter sp. DMC5)
MDAVPVLQPGAPTDVPAARDTAHGALPPPGEGRPKGRFALSPLNRRRLANFRGNGRGYWS
FVVFMVLFVLSLGAEFIANDKPILVSYDGGYYFPVFRAYPETAFGGDFETDADYRDPFLQ
KLIAEKGGWMVWPFIRFSYSTHNLDLPTPAPSPPTWMLTEAQCKAAAEKKGVSGCAGLEM
NWLGTDDQGRDVVARLIYGFRISVLFGLALTIVSSVVGVGAGAVQGYFGGWVDLLFQRFI
EIWTAIPSLYLLLIISSVLVPGFWVLLGILLLFSWVSLVGLVRAEFLRARNFEYVQAARA
LGVGNLTIMTRHMLPNAMVATLTMLPFILSSSVMTLTALDFLGFGLPPGSPSLGELLSQG
KNNIQAPWLGLTGFFTVAVMLSLLIFVGEAVRDAFDPRKTFG