Protein Info for GFF1645 in Variovorax sp. SCN45

Annotation: Sigma factor PvdS, controling pyoverdin biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 161 (146 residues), 58.6 bits, see alignment E=3e-20 PF04542: Sigma70_r2" amino acids 18 to 79 (62 residues), 30.4 bits, see alignment E=2.7e-11 PF08281: Sigma70_r4_2" amino acids 114 to 161 (48 residues), 41.7 bits, see alignment E=7.2e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 58% identity to vap:Vapar_3752)

Predicted SEED Role

"Sigma factor PvdS, controling pyoverdin biosynthesis" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF1645 Sigma factor PvdS, controling pyoverdin biosynthesis (Variovorax sp. SCN45)
MDMSLQPAEPTLGEVFIANRPQLQRVAQKIVRTADLADEVLQDAYLKLADGAAVRDVRKP
LGYCCQVVRNVAFDYHRHHSVEASYRTYCEDVELVSPPSNDAPERVLDGRQALAAIDRVL
DALPARTRTAFELNRLSGMTQREIGVRLGCSATLVNFMIKDADAALESCRYLVQGG