Protein Info for GFF1632 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphogluconate repressor HexR, RpiR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01418: HTH_6
  • amino acids 1 to 76 (76 residues), 101.7 bits, E=2.6e-33
• PF01380: SIS
  • amino acids 125 to 252 (128 residues), 103.3 bits, E=1.3e-33
• PF13580: SIS_2
  • amino acids 171 to 210 (40 residues), 27.8 bits, 3.5e-10

Best Hits

Swiss-Prot: 92% identical to HEXR_ECOLI: HTH-type transcriptional regulator HexR (hexR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ses:SARI_01059)

Predicted SEED Role

"Phosphogluconate repressor HexR, RpiR family"

Protein Sequence (289 amino acids)

>GFF1632 Phosphogluconate repressor HexR, RpiR family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNMLEKVQSQLEHLSKSERKVADVILAAPGRSIHLSIAMLAQEANVSEPTVNRFCRSMNT
RGFPDFKLHLAQSLANGTPYVNRNVDEDDSVEAYTGKIFESAMASLDHVRQSLDKSAVNR
AVDLLTQAKKIAFFGLGSSAAVAHDAMNKFFRFNVPVIYSDDIVLQRMSCMNCSDDDVVV
LISHTGRTKSLVELAQLARENDAMVIALTSAGTPLAREATLAITLDVPEDTDIYMPMVSR
LAQLTVIDVLATGFTLRRGAKFRDNLKRVKEALKESRFDKELLIKSDDR