Protein Info for GFF1631 in Variovorax sp. SCN45

Annotation: L-lysine 6-monooxygenase (Lysine N(6)-hydroxylase) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF13434: Lys_Orn_oxgnase" amino acids 2 to 345 (344 residues), 408.6 bits, see alignment E=2.2e-126 PF13454: NAD_binding_9" amino acids 9 to 162 (154 residues), 23.8 bits, see alignment E=4e-09

Best Hits

Swiss-Prot: 49% identical to PVDA_PSEAE: L-ornithine N(5)-monooxygenase (pvdA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03897, lysine N6-hydroxylase [EC: 1.14.13.59] (inferred from 71% identity to nmu:Nmul_A1825)

MetaCyc: 49% identical to L-ornithine 5-monooxygenase (Pseudomonas aeruginosa PAO1)
RXN-11128 [EC: 1.14.13.195]

Predicted SEED Role

"L-ornithine 5-monooxygenase (EC 1.13.12.-), PvdA of pyoverdin biosynthesis" in subsystem Siderophore Pyoverdine (EC 1.13.12.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.12.- or 1.14.13.195 or 1.14.13.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF1631 L-lysine 6-monooxygenase (Lysine N(6)-hydroxylase) protein (Variovorax sp. SCN45)
MQIHDLIGVGFGPSNIALAIALDEKRHHGQFVDALFIEKQPGFVWHKNMLLDNAHMQISF
IKDLATLRNPASRFTFLNYLHEKQRLQDFVNLKTFFPSRHEFNDYLGWAAAQFEDRCAYG
EAVFEVIPEMRGAEVQLLRVRSREADGTVRERLARNLVVSVGGVPNVPARFLPFREDARV
FHSSNYLEAIARHPDAKRIAIVGAGQSAAELFMDLQSHPNKPAVDLIMRARSIKPSDDSP
FVNEIFNADFTDFVFNRSEPERAELLEEFWHTNYAAPDLELIQQIFNVFYRQRVAGVARH
SFLRRHEVSAVRAAADGIHLSLHDMNTDQRGNQAYDVVILATGYKRDGHKALLDPIAPYL
GDFTVDRHYRLQAAPELKPGIFLQGACEMSHGLSDTLLSVTAIRSDEIGQALLNANPRTA
AAQPTQAAERTPRAAAVL