Protein Info for GFF1631 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Dihydroneopterin aldolase (EC 4.1.2.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02152: FolB
  • amino acids 12 to 116 (105 residues), 69.7 bits, E=1.6e-23

Best Hits

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 94% identity to aav:Aave_4226)

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• tetrahydromethanopterin biosynthesis (2/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25

Protein Sequence (124 amino acids)

>GFF1631 Dihydroneopterin aldolase (EC 4.1.2.25) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNASAAGNQILTLTGLRFDANLGILDHEKSSPQPIQVDAELNQGTQPLLPHDDDIGHVLD
YRKVRQIIIDECTAEHVNLLESLIGKLTRRLMQLPGVIGVRVKIAKLEIFDDCEVAIRME
SGQW