Protein Info for GFF1630 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FolM Alternative dihydrofolate reductase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 13 to 139 (127 residues), 31.6 bits, E=2.2e-11
• PF00106: adh_short
  • amino acids 13 to 201 (189 residues), 103.5 bits, E=1.6e-33
• PF13561: adh_short_C2
  • amino acids 21 to 251 (231 residues), 112.7 bits, E=3.3e-36

Best Hits

KEGG orthology group: None (inferred from 73% identity to vei:Veis_1465)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• folate transformations II (plants) (8/11 steps found)

Protein Sequence (262 amino acids)

>GFF1630 FolM Alternative dihydrofolate reductase 1 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPSATTPAVATRTVLVTGAGKRLGREIALALAQSGWNVAVHHRHSADEARRTADDCALRS
GRDGSARTFFADLGDEASVRALLPAVVAHFGRVDAVVNNASIFEHDSASSFGFAALEQHL
RANTGAPVLLAQALHAHLDARQAEGAVVNLLDQKLWNMNPDFFSYTLSKAALEAANTMLA
LALAPRVRVVGVAPGLTLTSHLLSDEKFAELHQQSPLGRSSSPQDVAATVAFALDNRSIT
GTTLLVDGGQHLMRFERDFSLM