Protein Info for GFF1630 in Methylophilus sp. DMC18

Annotation: Coenzyme A biosynthesis bifunctional protein CoaBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR00521: phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase" amino acids 10 to 389 (380 residues), 437.4 bits, see alignment E=2.5e-135 PF02441: Flavoprotein" amino acids 10 to 177 (168 residues), 115.8 bits, see alignment E=1.5e-37 PF04127: DFP" amino acids 188 to 367 (180 residues), 210.5 bits, see alignment E=1.9e-66

Best Hits

Swiss-Prot: 49% identical to COABC_VIBPA: Coenzyme A biosynthesis bifunctional protein CoaBC (coaBC) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: None (inferred from 84% identity to rcu:RCOM_1847870)

Predicted SEED Role

"Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36) / Phosphopantothenoylcysteine synthetase (EC 6.3.2.5)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.36, EC 6.3.2.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.36 or 6.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF1630 Coenzyme A biosynthesis bifunctional protein CoaBC (Methylophilus sp. DMC18)
MNAIYAKPLNILLGVTGGIAAYKTAELVRLLIKQGHRVQVVMTEAATHFITPTTLQALSG
QPVFIDSWDQRIANGMPHIELSRQADAILVAPASADFMAKLAHGFANDLLSTLCLARECP
LLVAPAMNRQMWENAATQRNVQQLRQDGVTVLGPDSGEQACGEVGQGRMLEPDHLLEALT
RFFTPKLLAGKNILITAGATMEMLDPVRGITNLSSGKMGFALAQAATRMGATVTLVYGHH
QVTPPEVSQACFAGSAGEMYQTVMQHIANQDVFIAVAAVADYRPQQISEQKLKKSESTLT
LALIKNKDILADIASLPNPPYCVGFAAESEQILEHARQKRLAKRIPMIVANHANSAMGSD
HNTVTIIDDQAETPLQADEKINIAFEILCHLHARLDPH