Protein Info for GFF1627 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA damage-inducible gene in SOS regulon, dependent on cyclic AMP and H-NS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 PF07130: YebG" amino acids 1 to 74 (74 residues), 114.8 bits, see alignment E=7.1e-38

Best Hits

Swiss-Prot: 79% identical to YEBG_ECO57: Uncharacterized protein YebG (yebG) from Escherichia coli O157:H7

KEGG orthology group: K09918, hypothetical protein (inferred from 99% identity to ses:SARI_01064)

Predicted SEED Role

"DNA damage-inducible gene in SOS regulon, dependent on cyclic AMP and H-NS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (96 amino acids)

>GFF1627 DNA damage-inducible gene in SOS regulon, dependent on cyclic AMP and H-NS (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAVEVKYVVIREGEEKMSFTSKKEADAWDKMLDTADLLDTWLEQSPVVLEDGQREALSLW
LAEHKEVLSTILKTGKLPSPQAVEKDAASKTKKQAA