Protein Info for GFF1621 in Variovorax sp. SCN45

Annotation: Phosphonoacetaldehyde dehydrogenase (NAD+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03250: putative phosphonoacetaldehyde dehydrogenase
  • amino acids 12 to 482 (471 residues), 880.6 bits, E=1.1e-269
• PF00171: Aldedh
  • amino acids 26 to 477 (452 residues), 480 bits, E=3.3e-148

Best Hits

Swiss-Prot: 58% identical to PHNY_RHIME: Phosphonoacetaldehyde dehydrogenase (phnY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00128, aldehyde dehydrogenase (NAD+) [EC: 1.2.1.3] (inferred from 93% identity to vpe:Varpa_1738)

MetaCyc: 58% identical to phosphonoacetaldehyde dehydrogenase (Sinorhizobium meliloti 1021)
1.2.1.-

Predicted SEED Role

"NAD-dependent aldehyde dehydrogenases"

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• 2-aminoethylphosphonate degradation II (2/2 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• octane oxidation (3/5 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (1/4 steps found)
• limonene degradation IV (anaerobic) (3/7 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• aromatic biogenic amine degradation (bacteria) (1/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3

Protein Sequence (482 amino acids)

>GFF1621 Phosphonoacetaldehyde dehydrogenase (NAD+) (Variovorax sp. SCN45)
MSQATLKPGIVHREALRIAGEKVHRDRTIEVTYPYTGEVIATVPKATLDDVRHALRVARD
YKPTLTRYERYKILMRAGEIIASRLDEISRTITMESGLCRKDSLYEVGRASDVLLFAANQ
ALVDDGQVFSCDLTHHGKSRKVYTLREPLQGAITAITPFNHPLNQVIHKVAPSIATNNRM
VLKPSEKTPLTAFVLADILYEAGLPPQMLSVITGDPAEIADELLTNADVDLVTFTGGVAI
GKYIAGKAVYKRQILELGGNDPIIVMEDADIEEAATLAASGSYKNSGQRCTAIKRMLVHE
SVADRFVELLVAKTKALKYGDPMDPATDMGTVIDEAAAIQFESVVNEAIKAGARLLYGNE
RRGALYSPTVLDHVDPQMTVARHETFGPVSPVIRFKNIEEAIRISNGTAYGLSSAVCTNR
MDYITRFIRELNVGSVNVREVPGYRLELTPFGGIKDSGLGYKEGVLEAMKSFTNCKTYSL
PW