Protein Info for GFF1615 in Variovorax sp. SCN45

Annotation: Phosphonate ABC transporter substrate-binding protein PhnD (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03431: phosphonate ABC transporter, periplasmic phosphonate binding protein" amino acids 11 to 281 (271 residues), 274.4 bits, see alignment E=1.2e-85 TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 11 to 248 (238 residues), 267.2 bits, see alignment E=1.5e-83 PF12974: Phosphonate-bd" amino acids 32 to 271 (240 residues), 249.2 bits, see alignment E=4e-78

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 73% identity to ppg:PputGB1_3255)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF1615 Phosphonate ABC transporter substrate-binding protein PhnD (TC 3.A.1.9.1) (Variovorax sp. SCN45)
MKTSFRLRRSLIALLLSTGAAMPALAVQPLTIGLIPAEDSQAMIESSRQVLDSLQQQLGM
PVKPFVATDYNGVIEALRAKKLDVAYLGPFSYVLASQVADVEAFAVAVTKKTGQSSYKSV
IIARKDSGIAKTADLKGRTFAFVDPTSASGHLFPKSGLLQAGHDPEAFFSRVIFSGSHDA
SILAVANKKVDAASVADRILASAIAKGQVKQDELEIVWSSSPIPESPMVWRKDLDPALKA
KIAKALANVKDLPWGDQGVLNGFQPTNDAAYNVVRDTAKVLKLDLRSMK